{"product_id":"proteintech-84100-3-rr","title":"Proteintech, 84100-3-RR, ACMSD Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACMSD (84100-3-RR) by Proteintech is a Recombinant antibody targeting ACMSD in WB, FC (Intra), ELISA applications with reactivity to human samples\n84100-3-RR targets ACMSD in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACMSD (alpha-amino-beta-carboxy-muconate-semialdehyde decarboxylase ) is the key enzyme that regulates the de novo NAD+ synthesis from tryptophan. ACMSD is highly expressed in the liver, kidney and to a lower degree in brain under physiological conditions. The enzyme is primarily cytosolic and is positioned at a critical branching point in the kynurenine pathway, wherein it influences the fate of the precursor 2-amino-3-carboxymuconic-6-semialdehyde (ACMS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25212 Product name: Recombinant human ACMSD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 47-252 aa of BC016018 Sequence: VSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEE Predict reactive species\nFull Name: aminocarboxymuconate semialdehyde decarboxylase\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC016018\nGene Symbol: ACMSD\nGene ID (NCBI): 130013\nRRID: AB_3671665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8TDX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888536604841,"sku":"84100-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84100-3-rr","provider":"Iright","version":"1.0","type":"link"}