{"product_id":"proteintech-84179-1-rr","title":"Proteintech, 84179-1-RR, EPS15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPS15 (84179-1-RR) by Proteintech is a Recombinant antibody targeting EPS15 in WB, ELISA applications with reactivity to human samples\n84179-1-RR targets EPS15 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  A431 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35282 Product name: Recombinant human EPS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 700-860 aa of NM_001981.3 Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK Predict reactive species\nFull Name: epidermal growth factor receptor pathway substrate 15\nCalculated Molecular Weight: 99 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_001981.3\nGene Symbol: EPS15\nGene ID (NCBI): 2060\nRRID: AB_3671734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42566\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612987049,"sku":"84179-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84179-1-rr","provider":"Iright","version":"1.0","type":"link"}