{"product_id":"proteintech-84218-1-rr","title":"Proteintech, 84218-1-RR, CPN1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CPN1 (84218-1-RR) by Proteintech is a Recombinant antibody targeting CPN1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84218-1-RR targets CPN1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman carboxypeptidase N (CPN), a member of the CPN\/E subfamily of \"regulatory\" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain. The C terminal region of the CPN1 subunit differs from all other family members in that it contains numerous basic residues. Proteolysis at these sites apparently happens either constitutively in the blood or during processing and secretion from the liver.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4035 Product name: Recombinant human CPN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-458 aa of BC027897 Sequence: RNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA Predict reactive species\nFull Name: carboxypeptidase N, polypeptide 1\nCalculated Molecular Weight: 458 aa, 52 kDa\nObserved Molecular Weight: 40~50 kDa\nGenBank Accession Number: BC027897\nGene Symbol: CPN1\nGene ID (NCBI): 1369\nRRID: AB_3671774\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15169\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888729280681,"sku":"84218-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84218-1-rr","provider":"Iright","version":"1.0","type":"link"}