{"product_id":"proteintech-84222-2-rr","title":"Proteintech, 84222-2-RR, NETO2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NETO2 (84222-2-RR) by Proteintech is a Recombinant antibody targeting NETO2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n84222-2-RR targets NETO2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, HEK-293 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropilin and tolloid-like 2 (NETO2), a member of the subfamily of CUB domain and LDLa-containing proteins, was identified as an auxiliary protein of neuronal kainate receptors (KARs) and played critical roles in regulating the functions of KARs. It was also able to bind to the active oligomeric form of K+-Cl− cotransporter (KCC2) to enhance its recycling in hippocampal neurons. Recently, elevated mRNA levels of NETO2 were detected in several types of tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2971 Product name: Recombinant human NETO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 378-525 aa of BC012381 Sequence: MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF Predict reactive species\nFull Name: neuropilin (NRP) and tolloid (TLL)-like 2\nCalculated Molecular Weight: 525 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC012381\nGene Symbol: NETO2\nGene ID (NCBI): 81831\nRRID: AB_3671776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8NC67\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888375091369,"sku":"84222-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84222-2-rr","provider":"Iright","version":"1.0","type":"link"}