{"product_id":"proteintech-84251-4-rr","title":"Proteintech, 84251-4-RR, COMMD9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COMMD9 (84251-4-RR) by Proteintech is a Recombinant antibody targeting COMMD9 in WB, ELISA applications with reactivity to human samples\n84251-4-RR targets COMMD9 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  A431 cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOMMD9, also known as HSPC166, is a member of the COMMD family of proteins. The COMMD protein family is an evolutionarily conserved gene family that plays a role in a number of critical biological processes, including inflammation, copper homeostasis, sodium balance, endosomal sorting and cancer. COMMD9 has been shown to participate in TFDP1\/E2F1 activation and to play a critical role in non-small cell lung cancer (PMID: 27871936)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35078 Product name: Recombinant human COMMD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC010892 Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK Predict reactive species\nFull Name: COMM domain containing 9\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC010892\nGene Symbol: COMMD9\nGene ID (NCBI): 29099\nRRID: AB_3671800\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9P000\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888607252649,"sku":"84251-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84251-4-rr","provider":"Iright","version":"1.0","type":"link"}