{"product_id":"proteintech-84282-1-rr","title":"Proteintech, 84282-1-RR, MLPH Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MLPH (84282-1-RR) by Proteintech is a Recombinant antibody targeting MLPH in WB, IHC, ELISA applications with reactivity to human samples\n84282-1-RR targets MLPH in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  MCF-7 cells,  PC-3 cells,  HT-29 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMelanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32931 Product name: Recombinant human MLPH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 372-600 aa of BC001653 Sequence: AGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS Predict reactive species\nFull Name: melanophilin\nCalculated Molecular Weight: 66 kDa\nObserved Molecular Weight: 66 kDa, 80 kDa\nGenBank Accession Number: BC001653\nGene Symbol: MLPH\nGene ID (NCBI): 79083\nRRID: AB_3671828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BV36\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888650375337,"sku":"84282-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84282-1-rr","provider":"Iright","version":"1.0","type":"link"}