{"product_id":"proteintech-84346-4-rr","title":"Proteintech, 84346-4-RR, EXOSC6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EXOSC6 (84346-4-RR) by Proteintech is a Recombinant antibody targeting EXOSC6 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84346-4-RR targets EXOSC6 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  MCF-7 cells,  HaCat cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEXOSC6 (exosome component 6), also known as p11 or MTR3. The calculated molecular weight of EXOSC6 is 28 kDa. And it has low tissue specificity. The gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. It is also a component of the RNA exosome complex (PMID: 29906447). The composition of human exosome is similar to its yeast counterpart. EXOSC6 is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33513 Product name: Recombinant human EXOSC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of NM_058219 Sequence: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP Predict reactive species\nFull Name: exosome component 6\nCalculated Molecular Weight: 28kd\nObserved Molecular Weight: 28-32 kDa\nGenBank Accession Number: NM_058219\nGene Symbol: EXOSC6\nGene ID (NCBI): 118460\nRRID: AB_3671887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5RKV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888742944937,"sku":"84346-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84346-4-rr","provider":"Iright","version":"1.0","type":"link"}