{"product_id":"proteintech-84356-1-rr","title":"Proteintech, 84356-1-RR, ACTN3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACTN3 (84356-1-RR) by Proteintech is a Recombinant antibody targeting ACTN3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84356-1-RR targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag36709 Product name: Recombinant human ACTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species\nFull Name: actinin, alpha 3\nCalculated Molecular Weight: 901 aa, 103 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC099647\nGene Symbol: ACTN3\nGene ID (NCBI): 89\nRRID: AB_3671894\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q08043\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888350875817,"sku":"84356-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84356-1-rr","provider":"Iright","version":"1.0","type":"link"}