{"product_id":"proteintech-84372-5-rr","title":"Proteintech, 84372-5-RR, IKKA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IKKA (84372-5-RR) by Proteintech is a Recombinant antibody targeting IKKA in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84372-5-RR targets IKKA in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HCT 116 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNF‐κB is regulated by phosphorylation of one of its cytoplasmic inhibitors, IκB, mediated by IκB kinases (IKK), allowing NF‐κB nuclear translocation and transcriptional activation. IKKα‐IKKβ heterodimer complexes regulate the DNA binding proteins implicated in the canonical NF‐κB pathway, including p50‐p65, while IKKα‐homodimers regulate p52‐RELB dimers implicated in the alternative NF‐κB pathway. (PMID: 34187082)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species\nFull Name: conserved helix-loop-helix ubiquitous kinase\nCalculated Molecular Weight: 85 kDa\nGenBank Accession Number: NM_001278\nGene Symbol: IKK Alpha\nGene ID (NCBI): 1147\nRRID: AB_3671908\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O15111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888766996649,"sku":"84372-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84372-5-rr","provider":"Iright","version":"1.0","type":"link"}