{"product_id":"proteintech-84425-5-rr","title":"Proteintech, 84425-5-RR, PERM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PERM1 (84425-5-RR) by Proteintech is a Recombinant antibody targeting PERM1 in IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n84425-5-RR targets PERM1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: H9C2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPERM1 (PGC-1\/ERR-induced regulator in muscle 1) is a muscle-specific protein induced by PGC-1α and ERRα. PERM1 protein expression is mainly restricted to heart and skeletal muscle, indicating PERM1 functions as a tissue-specific regulator of mitochondrial biogenesis in response to exercise (PMID: 33549681, 36028747). Ablation of Perm1 in mice results in reduced protein expression of lipin-1 accompanied by accumulation of specific phospholipid species (PMID: 33549681). There are two major isoforms of Perm1 protein, the short isoform is about 85 kDa, and the long isoform is 105 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23833 Product name: Recombinant human C1orf170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC006300 Sequence: MCLVFVAFATWAVRTSDPHTPDAWKTALLANVGTISAIRYFRRQAGQGRRSHSPSPSS Predict reactive species\nFull Name: chromosome 1 open reading frame 170\nGenBank Accession Number: BC006300\nGene Symbol: C1orf170\nGene ID (NCBI): 84808\nRRID: AB_3671952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5SV97\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888850653353,"sku":"84425-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84425-5-rr","provider":"Iright","version":"1.0","type":"link"}