{"product_id":"proteintech-84454-1-rr","title":"Proteintech, 84454-1-RR, OLFML1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe OLFML1 (84454-1-RR) by Proteintech is a Recombinant antibody targeting OLFML1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n84454-1-RR targets OLFML1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, U-251 cells,  HuH-7 cells,  mouse testis tissue,  rat testis tissue,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOLFML1 (Olfactomedin-like protein 1) is a novel member of human OLF protein family with an olfectamine domain (143-397 aa) in its C-terminus. OLFML1 exhibits the promotion of cell proliferation, along with the increase of percentage of S phase cells. OLFML1 is considered a secreted glycoprotein that enhances cell cycle progression in human cancer cell lines in vitro (PMID: 30266405). OLFML1 contains three potential N-glycosylation sites (residues 66, 138 and 183) and could be modified by the N-glycosylation (PMID: 18708057).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35125 Product name: Recombinant human OLFML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-160 aa of BC092488 Sequence: QRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIVSEDKTLAEMLLQEAEEEKKIRTLLNASCDNMLMGIKSLKIVKKMMDT Predict reactive species\nFull Name: olfactomedin-like 1\nCalculated Molecular Weight: 402 aa, 46 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC092488\nGene Symbol: OLFML1\nGene ID (NCBI): 283298\nRRID: AB_3671980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q6UWY5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888793735337,"sku":"84454-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84454-1-rr","provider":"Iright","version":"1.0","type":"link"}