{"product_id":"proteintech-84510-4-rr","title":"Proteintech, 84510-4-RR, TMEM41B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM41B (84510-4-RR) by Proteintech is a Recombinant antibody targeting TMEM41B in WB, ELISA applications with reactivity to human samples\n84510-4-RR targets TMEM41B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  A549 cells,  A2780 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species\nFull Name: transmembrane protein 41B\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC035034\nGene Symbol: TMEM41B\nGene ID (NCBI): 440026\nRRID: AB_3672019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5BJD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888670134441,"sku":"84510-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84510-4-rr","provider":"Iright","version":"1.0","type":"link"}