{"product_id":"proteintech-84514-4-rr","title":"Proteintech, 84514-4-RR, LASS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LASS2 (84514-4-RR) by Proteintech is a Recombinant antibody targeting LASS2 in WB, IHC, ELISA applications with reactivity to human samples\n84514-4-RR targets LASS2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HEK-293T cells,  MCF-7 cells,  K-562 cells\nPositive IHC detected in: Human Hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLASS2, also known as TMSG1, is a novel suppressor of human cancer metastasis. As one member of LASS family, including LASS1-6, LASS2 mRNA is at the highest level of all LASS members, and has the broadest tissue distribution, particularly abundant in the liver, kidney and brain in mice. The biological roles of LASS2 include protection from aging , hepatic INS resistance, and hepatocellular carcinoma (HCC) progression. LASS2 has been correlated with the degree of invasion and recurrence of carcinomas of the prostate, liver, breast and bladder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14151 Product name: Recombinant human LASS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-380 aa of BC010032 Sequence: LHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND Predict reactive species\nFull Name: LAG1 homolog, ceramide synthase 2\nCalculated Molecular Weight: 380 aa, 45 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC010032\nGene Symbol: LASS2\nGene ID (NCBI): 29956\nRRID: AB_3672021\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96G23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888647557289,"sku":"84514-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84514-4-rr","provider":"Iright","version":"1.0","type":"link"}