{"product_id":"proteintech-84520-1-rr","title":"Proteintech, 84520-1-RR, RIT2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RIT2 (84520-1-RR) by Proteintech is a Recombinant antibody targeting RIT2 in WB, IHC, ELISA applications with reactivity to human samples\n84520-1-RR targets RIT2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tssue,  fetal human brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRIT2 (AKA: Rin, Ras-like in neurons) is a small, neuronal, ras-like GTPase with enriched expression in SNc DANs (PMID: 38395968). RIT2 is a member of the Ras superfamily that plays important roles in many vital cellular functions, such as differentiation and survival (PMID: 29860660). Rit2 directly interacts with the DA transporter (DAT), and is required for regulated DAT membrane trafficking. In cell culture models, Rit2 is required for EGF- and NGF-mediated neurite outgrowth, NGF-mediated ERK phosphorylation, and cell viability (PMID: 38395968).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3160 Product name: Recombinant human RIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC018060 Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT Predict reactive species\nFull Name: Ras-like without CAAX 2\nCalculated Molecular Weight: 217 aa, 25 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC018060\nGene Symbol: RIT2\nGene ID (NCBI): 6014\nRRID: AB_3672027\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99578\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888815231145,"sku":"84520-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84520-1-rr","provider":"Iright","version":"1.0","type":"link"}