{"product_id":"proteintech-84531-5-rr","title":"Proteintech, 84531-5-RR, CDC20 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDC20 (84531-5-RR) by Proteintech is a Recombinant antibody targeting CDC20 in WB, IHC, ELISA applications with reactivity to human samples\n84531-5-RR targets CDC20 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  HepG2 cells,  PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCdc20 (Cell-division cycle protein 20 homologue) is also named as p55CDC and belongs to the WD repeat CDC20\/Fizzy family. Cdc20 has important functions in chromosome segregation and mitotic exit. Cdc20 is the target of the spindle assembly checkpoint (SAC) and a key cofactor of the anaphase-promoting complex or cyclosome (APC\/CCDC20) E3 ubiquitin ligase, thus regulating APC\/C ubiquitin activity on specific substrates for their subsequent degradation by the proteasome (PMID: 28202332). The 55-kDa band corresponded to the size of Cdc20 (PMID: 22566641).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0295 Product name: Recombinant human CDC20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC001088 Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSA Predict reactive species\nFull Name: cell division cycle 20 homolog (S. cerevisiae)\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC001088\nGene Symbol: CDC20\nGene ID (NCBI): 991\nRRID: AB_3672039\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q12834\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888604401833,"sku":"84531-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84531-5-rr","provider":"Iright","version":"1.0","type":"link"}