{"product_id":"proteintech-84572-4-rr","title":"Proteintech, 84572-4-RR, CTRL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CTRL (84572-4-RR) by Proteintech is a Recombinant antibody targeting CTRL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84572-4-RR targets CTRL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue, mouse pancreas tissue,  rat pancreas tissue\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTRL(Chymotrypsin-like protease) is also named as CTRL1 and belongs to the peptidase S1 family. The CTRL1 enzyme is active over a broad pH range. It expresses in pancreas and presence in intestinal fluid after stimulation of pancreatic secretion as a digestive enzyme(PMID:9065485). This gene encode a protein of 264 amino acid and the protein has a signal peptide of 18 amino acid and a propeptide of 15 amino acid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2214 Product name: Recombinant Human CTRL protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-264 aa of BC063475 Sequence: CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Predict reactive species\nFull Name: chymotrypsin-like\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC063475\nGene Symbol: CTRL\nGene ID (NCBI): 1506\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P40313\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888417755305,"sku":"84572-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84572-4-rr","provider":"Iright","version":"1.0","type":"link"}