{"product_id":"proteintech-84577-4-rr","title":"Proteintech, 84577-4-RR, WNT3A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe WNT3A (84577-4-RR) by Proteintech is a Recombinant antibody targeting WNT3A in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84577-4-RR targets WNT3A in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWNT3A belongs to wingless-type MMTV integration site family, and abnormal Wnt signalling is often associated with severe human diseases, including cancer, osteoporosis and other degenerative disorders. WNT3A is a secreted glycoprotein that is involved in both canonical and non-canonical Wnt signaling pathways. The canonical Wnt pathway, also known as the β-catenin-dependent pathway, regulates gene expression by stabilizing β-catenin, which then translocates to the nucleus and interacts with transcription factors like TCF\/LEF. It's shown to promote trophectoderm formation in embryonic stem cells. It's reported that the canonical Wnt\/β-catenin signaling pathway also contributes to the carcinogenesis and progression of lung cancer cell lines. The non-canonical pathways, which are β-catenin-independent, are involved in cytoskeletal organization and cell polarity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25051 Product name: Recombinant human WNT3A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-350 aa of BC103921 Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 3A\nCalculated Molecular Weight: 352 aa, 39 kDa\nGenBank Accession Number: BC103921\nGene Symbol: WNT3A\nGene ID (NCBI): 89780\nRRID: AB_3672077\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P56704\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888842690729,"sku":"84577-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84577-4-rr","provider":"Iright","version":"1.0","type":"link"}