{"product_id":"proteintech-84621-3-rr","title":"Proteintech, 84621-3-RR, SPARC Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SPARC (84621-3-RR) by Proteintech is a Recombinant antibody targeting SPARC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84621-3-RR targets SPARC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, A375 cells,  human placenta tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPARC, also known as ON (Osteonectin) or BM-40 (Basement-membrane protein 40), is an extracellular glycoprotein with the calculated molecular mass of 35 kDa and the apparent molecular mass of 40-43 kDa and 50 kDa (PMID: 7495300, 12365801). SPARC belongs to a group of matricellular proteins defined as secreted components that do not contribute directly to the formation of structural elements but serve to modulate cell-matrix interactions and cellular functions (PMID: 7542656; 12231357). SPARC is expressed at high levels in bone tissue, is distributed widely in many other tissues and cell types, and is associated generally with tissues undergoing morphogenesis, remodeling and wound repair (PMID: 10567433). It elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (PMID: 12721366). Altered expression of SPARC has been reported in a variety of cancers, which include breast, ovarian, colorectal, and pancreatic cancer as well as melanoma and glioblastomas (PMID: 18849185).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1169 Product name: Recombinant Human SPARC protein (His Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 18-303 aa of NM_003118.4 Sequence: APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Predict reactive species\nFull Name: secreted protein, acidic, cysteine-rich (osteonectin)\nCalculated Molecular Weight: 35kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: NM_003118.4\nGene Symbol: SPARC\nGene ID (NCBI): 6678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09486\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826011817,"sku":"84621-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84621-3-rr","provider":"Iright","version":"1.0","type":"link"}