{"product_id":"proteintech-84630-1-rr","title":"Proteintech, 84630-1-RR, ASXL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ASXL1 (84630-1-RR) by Proteintech is a Recombinant antibody targeting ASXL1 in WB, ELISA applications with reactivity to human samples\n84630-1-RR targets ASXL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  MCF-7 cells,  HL-60 cells,  COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdditional sex combs-like 1 (ASXL1) is a member of the ASXL family, which is involved in epigenetic regulation. It is one of the mammalian Asx homologs.  Mutations in the ASXL1 gene are frequently found in myeloid neoplasms, breast cancers, and prostate cancers (PMID: 30013160; PMID: 22436456; PMID: 26470845). In patients with myeloid malignancies, ASXL1 mutations are mostly heterozygous frameshift or nonsense mutations that result in C-terminal truncation (PMID: 30982744; PMID: 26095772; PMID: 32683582; PMID: 29643185).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10290 Product name: Recombinant human ASXL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC064984 Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR Predict reactive species\nFull Name: additional sex combs like 1 (Drosophila)\nCalculated Molecular Weight: 84aa,10 kDa; 1541aa,165 kDa\nObserved Molecular Weight: 200-220 kDa\nGenBank Accession Number: BC064984\nGene Symbol: ASXL1\nGene ID (NCBI): 171023\nRRID: AB_3672092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8IXJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888589918377,"sku":"84630-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84630-1-rr","provider":"Iright","version":"1.0","type":"link"}