{"product_id":"proteintech-84642-1-rr","title":"Proteintech, 84642-1-RR, UNC79 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UNC79 (84642-1-RR) by Proteintech is a Recombinant antibody targeting UNC79 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n84642-1-RR targets UNC79 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUNC79 is one of the key auxiliary subunits of the NALCN channel complex. Together with NALCN, FAM155A, and UNC80, it constitutes the NALCN channel body and is essential for maintaining neuronal excitability, motor function, pain sensitivity, and circadian rhythm (PMID: 35387979).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35440 Product name: Recombinant human UNC79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1740-1860 aa of NM_020818.4 Sequence: PLTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL Predict reactive species\nFull Name: KIAA1409\nCalculated Molecular Weight: 295 kDa\nGenBank Accession Number: NM_020818.4\nGene Symbol: UNC79\nGene ID (NCBI): 57578\nRRID: AB_3672101\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9P2D8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888839381161,"sku":"84642-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84642-1-rr","provider":"Iright","version":"1.0","type":"link"}