{"product_id":"proteintech-84649-2-rr","title":"Proteintech, 84649-2-RR, Ubiquilin 1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Ubiquilin 1 (84649-2-RR) by Proteintech is a Recombinant antibody targeting Ubiquilin 1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84649-2-RR targets Ubiquilin 1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MOLT-4 cells,  T-47D cells,  L02 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17530 Product name: Recombinant human Ubiquilin 1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 324-376 aa of BC010066 Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG Predict reactive species\nFull Name: ubiquilin 1\nCalculated Molecular Weight: 589 aa, 63 kDa\nObserved Molecular Weight: 63-71 kDa\nGenBank Accession Number: BC010066\nGene Symbol: Ubiquilin 1\nGene ID (NCBI): 29979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UMX0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888838561961,"sku":"84649-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84649-2-rr","provider":"Iright","version":"1.0","type":"link"}