{"product_id":"proteintech-84669-2-rr","title":"Proteintech, 84669-2-RR, KAT2A\/GCN5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KAT2A\/GCN5 (84669-2-RR) by Proteintech is a Recombinant antibody targeting KAT2A\/GCN5 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n84669-2-RR targets KAT2A\/GCN5 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HeLa cells,  MCF-7 cells,  LNCaP cells,  HSC-T6 cells\nPositive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29005 Product name: Recombinant human KAT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-449 aa of BC032743 Sequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR Predict reactive species\nFull Name: K(lysine) acetyltransferase 2A\nCalculated Molecular Weight: 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC032743\nGene Symbol: KAT2A\nGene ID (NCBI): 2648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888773648553,"sku":"84669-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84669-2-rr","provider":"Iright","version":"1.0","type":"link"}