{"product_id":"proteintech-84671-4-rr","title":"Proteintech, 84671-4-RR, DIAPH2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DIAPH2 (84671-4-RR) by Proteintech is a Recombinant antibody targeting DIAPH2 in WB, ELISA applications with reactivity to human samples\n84671-4-RR targets DIAPH2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293T cells,  HeLa cells,  Jurkat cells,  MCF-7 cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn vertebrates, three DRF genes (DIAPH1, DIAPH2 and DIAPH3) are the orthologs of the Drosophila melanogaster diaphanous (dia) gene, which has important roles in fertility and hearing in the fly. DIAPH1 and DIAPH3 have been associated with different types of hearing loss (HL). DIAPH2, located on chromosome Xq21.33, until now it has only been linked to premature ovarian failure 2 (POF2A). (PMID: 36689403)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35280 Product name: Recombinant human DIAPH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-146 aa of NM_006729.4 Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT Predict reactive species\nFull Name: diaphanous homolog 2 (Drosophila)\nCalculated Molecular Weight: 126kDa\nObserved Molecular Weight: 126-130 kDa\nGenBank Accession Number: NM_006729.4\nGene Symbol: DIAPH2\nGene ID (NCBI): 1730\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O60879\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888735834281,"sku":"84671-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84671-4-rr","provider":"Iright","version":"1.0","type":"link"}