{"product_id":"proteintech-84676-3-rr","title":"Proteintech, 84676-3-RR, GANC Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GANC (84676-3-RR) by Proteintech is a Recombinant antibody targeting GANC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84676-3-RR targets GANC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  mouse cerebellum tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGANC (Glucosidase Alpha, Neutral C) is a Protein Coding gene. Diseases associated with GANC include Pompe Disease and Autosomal Recessive Limb-Girdle Muscular Dystrophy Type 2A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35067 Product name: Recombinant human GANC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-210 aa of BC059406 Sequence: VTTDEDSTRFQIINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP Predict reactive species\nFull Name: glucosidase, alpha; neutral C\nCalculated Molecular Weight: 104 kDa\nObserved Molecular Weight: 100-105 kDa\nGenBank Accession Number: BC059406\nGene Symbol: GANC\nGene ID (NCBI): 2595\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8TET4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888637825193,"sku":"84676-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84676-3-rr","provider":"Iright","version":"1.0","type":"link"}