{"product_id":"proteintech-84678-4-rr","title":"Proteintech, 84678-4-RR, CST5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CST5 (84678-4-RR) by Proteintech is a Recombinant antibody targeting CST5 in WB, ELISA applications with reactivity to human samples\n84678-4-RR targets CST5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCST5 (cystatin D), it is expected to be located in cytoplasmic and extracellular, and the protein is restrictively expressed at salivary gland. Human cystatin D is a novel member of the cystatin superfamily of cysteine proteinase inhibitors present in saliva and tears. The inhibitory properties displayed by cystatin D suggest that it has a function in saliva as inhibitor of either endogenous or exogenous enzymes with cathepsin S- or H-like properties (PMID: 8083219). The calculated molecular weight of CST5 is 16 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34412 Product name: Recombinant human CST5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-142 aa of BC069514 Sequence: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV Predict reactive species\nFull Name: cystatin D\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC069514\nGene Symbol: CST5\nGene ID (NCBI): 1473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P28325\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888730394793,"sku":"84678-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84678-4-rr","provider":"Iright","version":"1.0","type":"link"}