{"product_id":"proteintech-84757-4-rr","title":"Proteintech, 84757-4-RR, RB1CC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RB1CC1 (84757-4-RR) by Proteintech is a Recombinant antibody targeting RB1CC1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n84757-4-RR targets RB1CC1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRB1CC1, also named as RBICC, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10508 Product name: Recombinant human RB1CC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1241-1594 aa of BC017556 Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV Predict reactive species\nFull Name: RB1-inducible coiled-coil 1\nCalculated Molecular Weight: 1594 aa, 183 kDa\nObserved Molecular Weight: 220 kDa\nGenBank Accession Number: BC017556\nGene Symbol: RB1CC1\nGene ID (NCBI): 9821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8TDY2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888813363369,"sku":"84757-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84757-4-rr","provider":"Iright","version":"1.0","type":"link"}