{"product_id":"proteintech-84767-4-rr","title":"Proteintech, 84767-4-RR, PSMD14\/POH1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PSMD14\/POH1 (84767-4-RR) by Proteintech is a Recombinant antibody targeting PSMD14\/POH1 in IF\/ICC, ELISA applications with reactivity to human samples\n84767-4-RR targets PSMD14\/POH1 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe PSMD14 (POH1, also known as Rpn11\/MPR1\/S13\/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection considerably impacted cell viability, causing cell arrest in the G0-G1 phase, ultimately leading to senescence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2694 Product name: Recombinant human PSMD14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC009524 Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14\nCalculated Molecular Weight: 35 kDa\nGenBank Accession Number: BC009524\nGene Symbol: PSMD14\nGene ID (NCBI): 10213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888864678057,"sku":"84767-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84767-4-rr","provider":"Iright","version":"1.0","type":"link"}