{"product_id":"proteintech-84782-5-rr","title":"Proteintech, 84782-5-RR, IGF1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IGF1 (84782-5-RR) by Proteintech is a Recombinant antibody targeting IGF1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to rat samples\n84782-5-RR targets IGF1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat plasma\nPositive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Transfected HEK-293T cells\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1976 Product name: Recombinant Rat IGF1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-92 aa of AAA41386 Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA Predict reactive species\nFull Name: insulin-like growth factor 1\nCalculated Molecular Weight: 14kd\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: AAA41386\nGene Symbol: Igf1\nGene ID (NCBI): 24482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08025\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888642576553,"sku":"84782-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84782-5-rr","provider":"Iright","version":"1.0","type":"link"}