{"product_id":"proteintech-84815-1-rr","title":"Proteintech, 84815-1-RR, Midkine Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Midkine (84815-1-RR) by Proteintech is a Recombinant antibody targeting Midkine in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84815-1-RR targets Midkine in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMidkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors\/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24547 Product name: Recombinant human MDK protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-143 aa of BC011704 Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species\nFull Name: midkine (neurite growth-promoting factor 2)\nCalculated Molecular Weight: 16 kDa\nGenBank Accession Number: BC011704\nGene Symbol: Midkine\nGene ID (NCBI): 4192\nRRID: AB_3672139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P21741\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888869331113,"sku":"84815-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84815-1-rr","provider":"Iright","version":"1.0","type":"link"}