{"product_id":"proteintech-84836-2-rr","title":"Proteintech, 84836-2-RR, CD3 Gamma Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD3 Gamma (84836-2-RR) by Proteintech is a Recombinant antibody targeting CD3 Gamma in WB, IHC, ELISA applications with reactivity to human samples\n84836-2-RR targets CD3 Gamma in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR\/CD3 complex of T-lymphocytes consists of either a TCR alpha\/beta or TCR gamma\/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2147 Product name: Recombinant Human CD3 gamma protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-116 aa of BC113830 Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS Predict reactive species\nFull Name: CD3g molecule, gamma (CD3-TCR complex)\nCalculated Molecular Weight: 182 aa, 20 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC113830\nGene Symbol: CD3 Gamma\nGene ID (NCBI): 917\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P09693\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888401862825,"sku":"84836-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84836-2-rr","provider":"Iright","version":"1.0","type":"link"}