{"product_id":"proteintech-84849-4-rr","title":"Proteintech, 84849-4-RR, NUAK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NUAK2 (84849-4-RR) by Proteintech is a Recombinant antibody targeting NUAK2 in WB, ELISA applications with reactivity to human samples\n84849-4-RR targets NUAK2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  SGC-7901 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUAK2, also known as OMPHK2 and SNARK, is the fourth member of the AMPK kinase family. The molecular mass of NUAK2 is 69 kDa and it plays a key role in neural tube closure during embryonic development (PMID: 32845958).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35302 Product name: Recombinant human NUAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10005287 of NM_030952 Sequence: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT Predict reactive species\nFull Name: NUAK family, SNF1-like kinase, 2\nCalculated Molecular Weight: 70kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_030952\nGene Symbol: NUAK2\nGene ID (NCBI): 81788\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9H093\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888793014441,"sku":"84849-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84849-4-rr","provider":"Iright","version":"1.0","type":"link"}