{"product_id":"proteintech-84859-3-rr","title":"Proteintech, 84859-3-RR, YARS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe YARS (84859-3-RR) by Proteintech is a Recombinant antibody targeting YARS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, pig samples\n84859-3-RR targets YARS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTyrosyl-tRNA synthetase (YARS) is responsible for tyrosyl-tRNA aminoacylation. The functional enzyme exists as a homodimer, has potent leukocyte and monocyte chemotaxis activity, and stimulates production of myeloperoxidase, tumor necrosis factor-α, and tissue factor. A shift in the monomer:dimer equilibrium could result in dysregulation of the cytokines function. (PMID: 33490854)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35148 Product name: Recombinant human YARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-528 aa of BC016689 Sequence: RTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS Predict reactive species\nFull Name: tyrosyl-tRNA synthetase\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC016689\nGene Symbol: YARS\nGene ID (NCBI): 8565\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P54577\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888843149481,"sku":"84859-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84859-3-rr","provider":"Iright","version":"1.0","type":"link"}