{"product_id":"proteintech-84869-1-rr","title":"Proteintech, 84869-1-RR, PDE10A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PDE10A (84869-1-RR) by Proteintech is a Recombinant antibody targeting PDE10A in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84869-1-RR targets PDE10A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDE10A (Phosphodiesterase 10A) is a single member of the PDE10 protein family, and it catalyzes both cAMP and cGMP hydrolysis (PMID: 34550322). The literature on PDE10A has been focused on psychiatric and neurological disorders because PDE10A expression is enriched in the striatal region of the brain under normal conditions (PMID: 12967715). Moreover, PDE10A expression is induced in various human tumor cell lines and PDE10A inhibition suppresses tumor cell growth (PMID: 37232184).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12771 Product name: Recombinant human PDE10A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 434-779 aa of BC104860 Sequence: KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED Predict reactive species\nFull Name: phosphodiesterase 10A\nCalculated Molecular Weight: 779 aa, 88 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC104860\nGene Symbol: PDE10A\nGene ID (NCBI): 10846\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888796979369,"sku":"84869-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84869-1-rr","provider":"Iright","version":"1.0","type":"link"}