{"product_id":"proteintech-84891-8-rr","title":"Proteintech, 84891-8-RR, AMACR\/p504S Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AMACR\/p504S (84891-8-RR) by Proteintech is a Recombinant antibody targeting AMACR\/p504S in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n84891-8-RR targets AMACR\/p504S in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  HEK-293 cells,  LNCaP cells,  DU 145 cells,  NIH\/3T3 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: DU 145 cells, LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMACR(Alpha-methyl acyl-CoA racemase) belongs to the CaiB\/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has  3 isoforms produced by alternative splicing and it can form a dimer of 70-75 kDa(PMID:21812041). Defects in AMACR are the cause of alpha-methyl acyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4005 Product name: Recombinant Human AMACR\/p504S protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 200-330 aa of NM_014324.6 Sequence: KLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPL Predict reactive species\nFull Name: alpha-methylacyl-CoA racemase\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: NM_014324.6\nGene Symbol: AMACR\nGene ID (NCBI): 23600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UHK6-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888692547753,"sku":"84891-8-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84891-8-rr","provider":"Iright","version":"1.0","type":"link"}