{"product_id":"proteintech-84917-5-rr","title":"Proteintech, 84917-5-RR, SHOC2\/Sur-8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SHOC2\/Sur-8 (84917-5-RR) by Proteintech is a Recombinant antibody targeting SHOC2\/Sur-8 in WB, ELISA applications with reactivity to human samples\n84917-5-RR targets SHOC2\/Sur-8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHOC2 is also named as Sur-8. The SHOC2 protein, along with MRAS and PP1C, forms a high affinity, heterotrimeric holoenzyme that activates RAF kinases by dephosphorylating a specific phosphoserine (PMID: 37074066). SHOC2, a key protein mediating the Ras-Raf-ERK pathway,  could act as a scaffolding protein to facilitate the activation of the pathway by mediating the interaction of key  components of the pathway (PMID: 37170083). The scaffold protein Shoc2 is a critical modulator of ERK1\/2 signals, and mutations in the shoc2 gene lead to the human developmental disease known as Noonan-like syndrome with loose anagen hair (NSLH) (PMID: 36265687).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11754 Product name: Recombinant human SHOC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-583 aa of BC050445 Sequence: GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV Predict reactive species\nFull Name: soc-2 suppressor of clear homolog (C. elegans)\nCalculated Molecular Weight: 582 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC050445\nGene Symbol: SHOC2\/Sur-8\nGene ID (NCBI): 8036\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UQ13\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821817513,"sku":"84917-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84917-5-rr","provider":"Iright","version":"1.0","type":"link"}