{"product_id":"proteintech-84935-6-rr","title":"Proteintech, 84935-6-RR, ATG12 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATG12 (84935-6-RR) by Proteintech is a Recombinant antibody targeting ATG12 in WB, IHC, ELISA applications with reactivity to human samples\n84935-6-RR targets ATG12 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG12, also named as APG12 and APG12L, belongs to the ATG12 family.  It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1791 Product name: Recombinant human ATG12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC012266 Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Predict reactive species\nFull Name: ATG12 autophagy related 12 homolog (S. cerevisiae)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC012266\nGene Symbol: ATG12\nGene ID (NCBI): 9140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O94817\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888709095593,"sku":"84935-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84935-6-rr","provider":"Iright","version":"1.0","type":"link"}