{"product_id":"proteintech-84941-1-rr","title":"Proteintech, 84941-1-RR, PLCG1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PLCG1 (84941-1-RR) by Proteintech is a Recombinant antibody targeting PLCG1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84941-1-RR targets PLCG1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphoinositide phospholipase C-gamma-1 (PLCG1) which belongs to the phosphoinositide-specific phospholipase C (PLC) family, is activated by many extracellular stimuli including hormones, neurotransmitters, and growth factors and modulates several cellular and physiological functions necessary for tumorigeneses such as cell survival, migration, invasion, and angiogenesis by generating inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG) via hydrolysis of phosphatidylinositol 4,5-biphosphate (PIP2) (PMID: 9242915). Phosphorylation is one of the key mechanisms that regulate the activity of PLC. PLCγ is activated by both receptor and non-receptor tyrosine kinases (PMID: 2472218). PLCγ forms a complex with EGF and PDGF receptors, which leads to the phosphorylation of PLCγ at Tyr771, 783, and 1248 (PMID: 1708307). It has also been shown that PKA-mediated phosphorylation at Ser1248 is inhibitory to PLCγ1 tyrosine phosphorylation and phospholipase activity in CD3-treated Jurkat cells (PMID: 1370476), suggesting that Ser1248 may be an allosteric regulator of PLCγ1 activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27218 Product name: Recombinant human PLCG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-563 aa of Sequence: AEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH Predict reactive species\nFull Name: phospholipase C, gamma 1\nCalculated Molecular Weight: 149 kDa\nGene Symbol: PLCG1\nGene ID (NCBI): 5335\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P19174\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888806744233,"sku":"84941-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84941-1-rr","provider":"Iright","version":"1.0","type":"link"}