{"product_id":"proteintech-84958-5-rr","title":"Proteintech, 84958-5-RR, USP33 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe USP33 (84958-5-RR) by Proteintech is a Recombinant antibody targeting USP33 in WB, ELISA applications with reactivity to human samples\n84958-5-RR targets USP33 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP33(Ubiquitin carboxyl-terminal hydrolase 33) is also named as KIAA1097, VDU1 and belongs to the peptidase C19 family. This protein, originally identified as a von Hippel-Lindau tumor suppressor (VHL) protein-interacting deubiquitinating enzyme, binds to the Robo1 receptor, and that USP33 is required for Slit responsiveness in breast cancer cells(PMID:19706539). The localization of USP33 is broadly confined to the secretory pathway, with all variants localizing to endoplasmic reticulum-associated structures(PMID:21801292). It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14268 Product name: Recombinant human USP33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-472 aa of BC016663 Sequence: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR Predict reactive species\nFull Name: ubiquitin specific peptidase 33\nCalculated Molecular Weight: 942 aa, 107 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC016663\nGene Symbol: USP33\nGene ID (NCBI): 23032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TEY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888840036521,"sku":"84958-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84958-5-rr","provider":"Iright","version":"1.0","type":"link"}