{"product_id":"proteintech-84962-4-rr","title":"Proteintech, 84962-4-RR, GOSR2\/Membrin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GOSR2\/Membrin (84962-4-RR) by Proteintech is a Recombinant antibody targeting GOSR2\/Membrin in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84962-4-RR targets GOSR2\/Membrin in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  L02 cells,  mouse liver tissue,  rat liver tissue,  human placenta tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the soluble NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in the Golgi apparatus. It is involved in the transport of proteins from the cis\/medial-Golgi to the trans-Golgi network.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2736 Product name: Recombinant human GOSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC009710 Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF Predict reactive species\nFull Name: golgi SNAP receptor complex member 2\nCalculated Molecular Weight: 212 aa, 25 kDa\nObserved Molecular Weight: 23-25 kDa\nGenBank Accession Number: BC009710\nGene Symbol: Membrin\nGene ID (NCBI): 9570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O14653\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888639266985,"sku":"84962-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84962-4-rr","provider":"Iright","version":"1.0","type":"link"}