{"product_id":"proteintech-84969-4-rr","title":"Proteintech, 84969-4-RR, RAD50 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RAD50 (84969-4-RR) by Proteintech is a Recombinant antibody targeting RAD50 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84969-4-RR targets RAD50 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells,  Jurkat cells,  MOLT-4 cells,  C6 cells\nPositive IHC detected in: human placenta tissue, human stomach cancer tissue,  mouse brain tissue,  mouse lung tissue,  mouse stomach tissue,  rat brain tissue,  rat lung tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself,  allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29949 Product name: Recombinant human RAD50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-425 aa of NM_005732 Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK Predict reactive species\nFull Name: RAD50 homolog (S. cerevisiae)\nCalculated Molecular Weight: 154 kDa\nObserved Molecular Weight: 154 kDa\nGenBank Accession Number: NM_005732\nGene Symbol: RAD50\nGene ID (NCBI): 10111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92878\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888812871849,"sku":"84969-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84969-4-rr","provider":"Iright","version":"1.0","type":"link"}