{"product_id":"proteintech-84991-4-rr","title":"Proteintech, 84991-4-RR, TRMT10C Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TRMT10C (84991-4-RR) by Proteintech is a Recombinant antibody targeting TRMT10C in WB, ELISA applications with reactivity to human, rat samples\n84991-4-RR targets TRMT10C in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  K-562 cells,  PC-12 cells,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\ntRNA methyltransferase 10 homolog C (TRMT10C, also known as MRPP1) is involved in mitochondrial RNA processing and modification (PMID: 21593607). It is essential for the 5'-ends processing of mitochondrial tRNAs and plays a critical role in mitochondrial respiration and translation (PMID: 18984158; 29040705). Mutations in TRMT10C may be a cause of mitochondrial disease and highlight the importance of RNA processing for correct mitochondrial function (PMID: 27132592).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30642 Product name: Recombinant human TRMT10C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-178 aa of NM_017819 Sequence: MSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFL Predict reactive species\nFull Name: RNA (guanine-9-) methyltransferase domain containing 1\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_017819\nGene Symbol: TRMT10C\nGene ID (NCBI): 54931\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q7L0Y3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888671379625,"sku":"84991-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84991-4-rr","provider":"Iright","version":"1.0","type":"link"}