{"product_id":"proteintech-85010-1-rr","title":"Proteintech, 85010-1-RR, LAIR1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LAIR1 (85010-1-RR) by Proteintech is a Recombinant antibody targeting LAIR1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to mouse samples\n85010-1-RR targets LAIR1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1879 Product name: Recombinant Mouse LAIR1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-141 aa of NM_001113474.1 Sequence: QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY Predict reactive species\nFull Name: leukocyte-associated Ig-like receptor 1\nCalculated Molecular Weight: 30kDa\nObserved Molecular Weight: 35 kDa, 45 kDa\nGenBank Accession Number: NM_001113474.1\nGene Symbol: Lair1\nGene ID (NCBI): 52855\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8BG84-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888647295145,"sku":"85010-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85010-1-rr","provider":"Iright","version":"1.0","type":"link"}