{"product_id":"proteintech-85025-6-rr","title":"Proteintech, 85025-6-RR, Dysadherin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Dysadherin (85025-6-RR) by Proteintech is a Recombinant antibody targeting Dysadherin in WB, ELISA applications with reactivity to human samples\n85025-6-RR targets Dysadherin in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, MDA-MB-231 cells,  NCI-H1299 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDysadherin (also known as FXYD5) is a cancer-related transmembrane glycoprotein, belonging to FXYD family. It is overexpressed on the surface of many tumor cells, and promotes the movement, migration and metastasis of tumor cells by reducing E-cadherin(E- cadherin) dependent intercellular adhesion. Its main function also includes regulating the activity of na, k-ATPase. It is also a typical \"abnormal migration\" protein-its SDS-PAGE apparent molecular weight (35-55 kDa) is much higher than the theoretical calculation value (~20 kDa). This difference is mainly caused by extensive O- glycosylation modification, which is particularly important in cancer research, because tumor cells often show a higher degree of glycosylation (50-55 kDa), which may be related to their metastasis promoting function(PMID: 17442482;41535258).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5715 Product name: Recombinant human FXYD5\/Dysadherin protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-145 aa of NM_001164605.2 Sequence: QTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 5\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 35-55 kDa\nGenBank Accession Number: NM_001164605.2\nGene Symbol: Dysadherin\nGene ID (NCBI): 53827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96DB9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888738488489,"sku":"85025-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85025-6-rr","provider":"Iright","version":"1.0","type":"link"}