{"product_id":"proteintech-85037-5-rr","title":"Proteintech, 85037-5-RR, SEC22B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SEC22B (85037-5-RR) by Proteintech is a Recombinant antibody targeting SEC22B in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, hamster samples\n85037-5-RR targets SEC22B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  CHO cells,  mouse brain tissue,  rat brain tissue,  fetal human brain tissue,  human placenta tissue\nPositive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSoluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)\/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12981 Product name: Recombinant human SEC22B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-215 aa of BC001364 Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL Predict reactive species\nFull Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC001364\nGene Symbol: SEC22B\nGene ID (NCBI): 9554\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75396\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888819916969,"sku":"85037-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85037-5-rr","provider":"Iright","version":"1.0","type":"link"}