{"product_id":"proteintech-85049-4-rr","title":"Proteintech, 85049-4-RR, KCNA3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KCNA3 (85049-4-RR) by Proteintech is a Recombinant antibody targeting KCNA3 in WB, ELISA applications with reactivity to human samples\n85049-4-RR targets KCNA3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKv1.3 ( also known as KCNA3, MK3, HGK5, HLK3, PCN3, HPCN3) contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, which allows nerve cells to repolarize following an action potential efficiently. It plays an essential role in T cell proliferation and activation. Kv1.3 channels are expressed in various tissues and cell types including the brain, vascular smooth muscle cells, and leucocytes. Malfunction of Kv1.3 can alter the immune response, elicit neurotoxic effects or impact on cancer growth(PMID: 24305723; 24133455).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5204 Product name: Recombinant human KCNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-226 aa of BC035059 Sequence: DERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY Predict reactive species\nFull Name: potassium voltage-gated channel, shaker-related subfamily, member 3\nCalculated Molecular Weight: 575 aa, 64 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC035059\nGene Symbol: KCNA3\nGene ID (NCBI): 3738\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22001\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888645820585,"sku":"85049-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85049-4-rr","provider":"Iright","version":"1.0","type":"link"}