{"product_id":"proteintech-85068-5-rr","title":"Proteintech, 85068-5-RR, UFM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UFM1 (85068-5-RR) by Proteintech is a Recombinant antibody targeting UFM1 in WB, ELISA applications with reactivity to human samples\n85068-5-RR targets UFM1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HuH-7 cells,  HEK-293T cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUFM1 (Ubiquitin-fold modifier 1) is a ubiquitin-like protein covalently conjugated with intracellular proteins through UFMylation (modification by UFM1), a process similar to ubiquitylation (PMID: 38141606). UFM1 is conjugated to its target proteins by E1-like activating enzyme UBE1DC1 and E2-like conjugating enzyme UFC1 in a manner analogous to ubiquitylation (PMID: 28234446; 33066455). At the molecular level, UFMylation is an important mediator of the protein function. Dysregulation of the UFM1 system, e.g., the knockout of UFMylation components, disturbs proteome homeostasis and triggers endoplasmic reticulum stress. Such changes are linked to developmental disorders, tumorigenesis, tissue injury, inflammation, and several hereditary neurological syndromes (PMID: 36932998).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8667 Product name: Recombinant human UFM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC005193 Sequence: MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC Predict reactive species\nFull Name: ubiquitin-fold modifier 1\nCalculated Molecular Weight: 85 aa, 9 kDa\nObserved Molecular Weight: 9-12 kDa\nGenBank Accession Number: BC005193\nGene Symbol: UFM1\nGene ID (NCBI): 51569\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P61960\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888838758569,"sku":"85068-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85068-5-rr","provider":"Iright","version":"1.0","type":"link"}