{"product_id":"proteintech-85108-5-rr","title":"Proteintech, 85108-5-RR, SYTL5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SYTL5 (85108-5-RR) by Proteintech is a Recombinant antibody targeting SYTL5 in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples\n85108-5-RR targets SYTL5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, U-251 cells\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYTL5, also known as SLP5, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by the presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL5 promotes the development and progression of papillary thyroid carcinoma (PTC) by activating the NF-κB signaling pathway (PMID: 36378561).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21698 Product name: Recombinant human SYTL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-343 aa of BC131585 Sequence: TQQEASRVCVHCHRNLGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVRQSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYGFENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSI Predict reactive species\nFull Name: synaptotagmin-like 5\nCalculated Molecular Weight: 730 aa, 81 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC131585\nGene Symbol: SYTL5\nGene ID (NCBI): 94122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TDW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888668725417,"sku":"85108-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85108-5-rr","provider":"Iright","version":"1.0","type":"link"}