{"product_id":"proteintech-85110-4-rr","title":"Proteintech, 85110-4-RR, SEC13 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SEC13 (85110-4-RR) by Proteintech is a Recombinant antibody targeting SEC13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85110-4-RR targets SEC13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  HepG2 cells,  A431 cells,  RAW 264.7 cells,  mouse pancreas tissue,  rat pancreas tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC13 is a component of the nuclear pore complex (NPC) and the COPII coat. It is required for esicle biogenesis from endoplasmic reticulum during the transport of proteins. Shuttling of SEC13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments. (PMID: 14517296; 16407955)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7610 Product name: Recombinant human SEC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC002634 Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ Predict reactive species\nFull Name: SEC13 homolog (S. cerevisiae)\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC002634\nGene Symbol: SEC13\nGene ID (NCBI): 6396\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P55735\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888665415849,"sku":"85110-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85110-4-rr","provider":"Iright","version":"1.0","type":"link"}