{"product_id":"proteintech-85114-1-rr","title":"Proteintech, 85114-1-RR, HCLS1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HCLS1 (85114-1-RR) by Proteintech is a Recombinant antibody targeting HCLS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n85114-1-RR targets HCLS1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse thymus tissue,  rat thymus tissue,  Ramos cells,  Daudi cells,  Raji cells\nPositive IHC detected in: mouse thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEL cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8645 Product name: Recombinant human HCLS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 142-486 aa of BC016758 Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE Predict reactive species\nFull Name: hematopoietic cell-specific Lyn substrate 1\nCalculated Molecular Weight: 486 aa, 54 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC016758\nGene Symbol: HCLS1\nGene ID (NCBI): 3059\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P14317\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888760213673,"sku":"85114-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85114-1-rr","provider":"Iright","version":"1.0","type":"link"}