{"product_id":"proteintech-85121-4-rr","title":"Proteintech, 85121-4-RR, Adiponectin receptor Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Adiponectin receptor (85121-4-RR) by Proteintech is a Recombinant antibody targeting Adiponectin receptor in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n85121-4-RR targets Adiponectin receptor in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  L02 cells,  rat uterus tissue,  human placenta tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: rat liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver (PMID: 12802337). The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5744 Product name: Recombinant human ADIPOR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC051858 Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG Predict reactive species\nFull Name: adiponectin receptor 2\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC051858\nGene Symbol: Adiponectin receptor\nGene ID (NCBI): 79602\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86V24\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888343896233,"sku":"85121-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-85121-4-rr","provider":"Iright","version":"1.0","type":"link"}